DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and CG5254

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:291 Identity:61/291 - (20%)
Similarity:115/291 - (39%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GFASMCVAFAVAPIDIVKTHMQIQ---RQKRSILGTV---------KRIHSLKGYLGFYDGFSAA 79
            ||..:|:   :.|:|:|||.:|||   ....:.||.|         .:::..:|...::.|....
  Fly    25 GFLEVCI---MQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIMPP 86

  Fly    80 ILRQMTSTNIHFIVYDTGKKMEYV--DRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142
            ||.:.....|.|:|::..|.:...  ...:.|...:.|..||...:....|.:::.|..|.|   
  Fly    87 ILAETPKRAIKFLVFEQTKPLFQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQAD--- 148

  Fly   143 PPYKRRNYKHVF---------DGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEV 198
               :::.....|         |||       |:..|.||.:..:.::.:.......||..:|..|
  Fly   149 ---RQKKMLSTFAVAKGIIQQDGL-------GFSGLNKGITATMGRNGVFNMVYFGFYHSVKNVV 203

  Fly   199 RKNISVNDGLPLHFLTSLGTSIISSA----ITHPLDVVRTIMMNSR--PGEFR---TVFQASVHM 254
            .:....:    |.||..:....::..    :..|.||.::.:...:  ||:.:   |:....:..
  Fly   204 PEYKESH----LEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSSMGIVY 264

  Fly   255 MRFGVMGPYRGFVPTIVRKAPATTLLFVLYE 285
            ...|....|:|.||.|:|..|...:|.:::|
  Fly   265 REEGFRALYKGLVPKIMRLGPGGAILLLVFE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 61/291 (21%)
Mito_carr 26..100 CDD:278578 22/84 (26%)
Mito_carr 104..201 CDD:278578 20/105 (19%)
Mito_carr 211..292 CDD:278578 18/84 (21%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 22/89 (25%)
PTZ00169 19..301 CDD:240302 61/291 (21%)
Mito_carr 122..207 CDD:278578 19/97 (20%)
Mito_carr 209..305 CDD:278578 19/91 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.