DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Slc25a10

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:283 Identity:105/283 - (37%)
Similarity:164/283 - (57%) Gaps:9/283 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQ-KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            |....||:|||.||...|....|:|::|.|:|.|:: |..:.|...::....|:|..|:|.||::
Mouse     3 EARASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALYNGLSASL 67

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRDS-----YLGKIILGCVAGACGSAFGIPTDLINVRMQTDM 140
            .||||.:...|.:|:|.:  :|:.:||     :..|::||.::|..|...|.|.||:|||||.||
Mouse    68 CRQMTYSLTRFAIYETMR--DYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDM 130

  Fly   141 KEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVN 205
            |.||.:||||.|..|||.|:.:||..:.|:.|.::|..:.:|.|..|::.||..|..|.....::
Mouse   131 KLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLS 195

  Fly   206 DGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPTI 270
            |.:..||::|......::.:..||||::|.:|||: ||::.||..::...:.|....::|..|..
Mouse   196 DNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAMETAKLGPQAFFKGLFPAG 259

  Fly   271 VRKAPATTLLFVLYEQLRLHFGI 293
            :|..|.|.|.|:..||||.||||
Mouse   260 IRLIPHTVLTFMFLEQLRKHFGI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 95/267 (36%)
Mito_carr 26..100 CDD:278578 26/74 (35%)
Mito_carr 104..201 CDD:278578 42/101 (42%)
Mito_carr 211..292 CDD:278578 28/80 (35%)
Slc25a10NP_038798.2 Solcar 1 7..87 29/81 (36%)
Mito_carr 12..92 CDD:278578 27/81 (33%)
Mito_carr 94..189 CDD:278578 39/94 (41%)
Solcar 2 100..187 39/86 (45%)
Solcar 3 196..279 28/83 (34%)
Mito_carr 197..283 CDD:278578 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.760

Return to query results.
Submit another query.