DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and SLC25A30

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:265 Identity:72/265 - (27%)
Similarity:123/265 - (46%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVAPIDIVKTHMQIQRQK----------RSILGTVKRIHSLKGYLGFYDGFSAA 79
            :||.||:.......|||:.||.:|||.|.          |.:|..:.||...:|....|.|.:.|
Human    11 YGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPA 75

  Fly    80 ILRQMTSTNIHFIVYDTGKKMEYVDR--DSYLG-KIILGCVAGACGSAFGIPTDLINVRMQTDMK 141
            :|||.:...|....|.:.|:: :::|  |..|. .:|.|.::|...|....|||::.:|||....
Human    76 MLRQASYGTIKIGTYQSLKRL-FIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSN 139

  Fly   142 EPPYKRRNYKHVFDGLI----RIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNI 202
            .          :..|:|    .|.::||.:.|:||.|:...::::....::..|||.|..:..:.
Human   140 T----------IQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSG 194

  Fly   203 SVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFV 267
            .:.|.:..|||:|....:..:..::|:|||||.|||.|             ::|.|....|.|.:
Human   195 LMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQR-------------VLRDGRCSGYTGTL 246

  Fly   268 PTIVR 272
            ..:::
Human   247 DCLLQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 72/264 (27%)
Mito_carr 26..100 CDD:278578 27/83 (33%)
Mito_carr 104..201 CDD:278578 26/103 (25%)
Mito_carr 211..292 CDD:278578 18/62 (29%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 27/89 (30%)
Mito_carr 102..191 CDD:278578 25/98 (26%)
Mito_carr 199..>252 CDD:278578 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.