DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Ucp1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus


Alignment Length:281 Identity:78/281 - (27%)
Similarity:136/281 - (48%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVA-PIDIVKTHMQIQRQ--------KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            |....|.|:|..:. |:|..|..:|||.:        .:.:|||:..:...:|....|.|..|.|
  Rat    18 FSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGI 82

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYV----DRDSYLG-KIILGCVAGACGSAFGIPTDLINVRMQTDM 140
            .||::..::...:|||  ..||.    :..:.|| ||..|.:.|......|.||:::.||||...
  Rat    83 QRQISFASLRIGLYDT--VQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQS 145

  Fly   141 KEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVN 205
            .....|.| |...::....|...|....|:||.:..:.::.:..|:::..||::|..:..:..:.
  Rat   146 HLHGIKPR-YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILA 209

  Fly   206 DGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGP---YRGFV 267
            |.:|.|.|::|.....::.:..|:|||:|..:||.||::.:|  .|..|..:...||   ::||.
  Rat   210 DDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSV--PSCAMTMYTKEGPAAFFKGFA 272

  Fly   268 PTIVRKAPATTLLFVLYEQLR 288
            |:.:|......::||.:|||:
  Rat   273 PSFLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 76/278 (27%)
Mito_carr 26..100 CDD:278578 22/82 (27%)
Mito_carr 104..201 CDD:278578 25/97 (26%)
Mito_carr 211..292 CDD:278578 26/81 (32%)
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 24/86 (28%)
Solcar 1 11..102 23/85 (27%)
PTZ00169 21..297 CDD:240302 77/278 (28%)
Mito_carr 110..205 CDD:278578 25/95 (26%)
Solcar 2 111..201 25/90 (28%)
Solcar 3 210..295 28/86 (33%)
Mito_carr 215..300 CDD:278578 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.