DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Ucp1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_033489.1 Gene:Ucp1 / 22227 MGIID:98894 Length:307 Species:Mus musculus


Alignment Length:281 Identity:78/281 - (27%)
Similarity:136/281 - (48%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVA-PIDIVKTHMQIQRQ--------KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            |....|.|:|..:. |:|..|..:|||.:        .:.:|||:..:...:|....|.|..|.|
Mouse    18 FSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGI 82

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYV----DRDSYLG-KIILGCVAGACGSAFGIPTDLINVRMQTDM 140
            .||::..::...:||:  ..||.    :..:.|| ||..|.:.|......|.||:::.||||...
Mouse    83 QRQISFASLRIGLYDS--VQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQS 145

  Fly   141 KEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVN 205
            .....|.| |...::....|...|....|:||.:..:.::.:..|:::..||::|..:..|..:.
Mouse   146 HLHGIKPR-YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNNKILA 209

  Fly   206 DGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGP---YRGFV 267
            |.:|.|.|::|.....::.:..|:|||:|..:||.||::.:|  .|..|..:...||   ::|||
Mouse   210 DDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSV--PSCAMSMYTKEGPTAFFKGFV 272

  Fly   268 PTIVRKAPATTLLFVLYEQLR 288
            .:.:|......::||.:|||:
Mouse   273 ASFLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 76/278 (27%)
Mito_carr 26..100 CDD:278578 21/82 (26%)
Mito_carr 104..201 CDD:278578 25/97 (26%)
Mito_carr 211..292 CDD:278578 26/81 (32%)
Ucp1NP_033489.1 Mito_carr 10..103 CDD:278578 23/86 (27%)
Solcar 1 11..102 22/85 (26%)
PTZ00169 21..297 CDD:240302 77/278 (28%)
Mito_carr 110..206 CDD:278578 25/96 (26%)
Solcar 2 111..201 25/90 (28%)
Solcar 3 210..295 28/86 (33%)
Mito_carr 215..300 CDD:278578 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.