DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Slc25a14

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001277634.1 Gene:Slc25a14 / 20523 MGIID:1330823 Length:344 Species:Mus musculus


Alignment Length:287 Identity:79/287 - (27%)
Similarity:137/287 - (47%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVAPIDIVKTHMQIQRQK----------RSILGTVKRIHSLKGYLGFYDGFSAA 79
            :||.||:...|...|:|:.||.:|:|.|.          |.:...:.||:..:|.|..|.|.:.|
Mouse    65 YGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPA 129

  Fly    80 ILRQMTSTNIHFIVYDTGKKM--EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142
            :|||.:...|...:|.:.|::  |.::.::.|..:|.|.|:|...|....|||::.:|||..   
Mouse   130 LLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQ--- 191

  Fly   143 PPYKRRNYKHVFDG-----LIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNI 202
                    ..:|.|     .|.|.::||.:.|::|......::::....::..|||.|..:..:.
Mouse   192 --------GSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSG 248

  Fly   203 SVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRP--GE---FRTVFQASVHMMRF-GVMG 261
            .:.|.:..||::|....:..:..::|:|||||.|||.|.  |.   ::......:.|.:. |...
Mouse   249 MLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFA 313

  Fly   262 PYRGFVPTIVRKAPATTLLFVLYEQLR 288
            .|:||.|..:|..|...:.|:.||||:
Mouse   314 LYKGFWPNWLRLGPWNIIFFITYEQLK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 78/284 (27%)
Mito_carr 26..100 CDD:278578 26/83 (31%)
Mito_carr 104..201 CDD:278578 24/101 (24%)
Mito_carr 211..292 CDD:278578 27/84 (32%)
Slc25a14NP_001277634.1 PTZ00169 63..342 CDD:240302 79/287 (28%)
Mito_carr 253..342 CDD:365909 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.