DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and slc-25A10

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_509133.1 Gene:slc-25A10 / 180940 WormBaseID:WBGene00019656 Length:290 Species:Caenorhabditis elegans


Alignment Length:275 Identity:113/275 - (41%)
Similarity:168/275 - (61%) Gaps:2/275 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTVK-RIHSLKGYLGFYDGFSAAILRQ 83
            |.||:|||.|....|....|:|::|..:|.|:|.:..:|.:. :|:...|.|.||:|.||::|||
 Worm     9 LGRWYFGGVAGAMAACCTHPLDLLKVQLQTQQQGKLTIGQLSLKIYKNDGILAFYNGVSASVLRQ 73

  Fly    84 MTSTNIHFIVYDTGKKMEYVDRD-SYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYKR 147
            :|.:...|.:|:|.||....|:. .:..|.:|...|||||...|.|.||:|||||.|.|.|..:|
 Worm    74 LTYSTTRFGIYETVKKQLPQDQPLPFYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQR 138

  Fly   148 RNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLPLHF 212
            |||||..|||:||.:|||:..::.|.::|..::.|.|..|::|||.||..:..:....|.|..||
 Worm   139 RNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLISSGVAEDNLQTHF 203

  Fly   213 LTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPTIVRKAPAT 277
            .:|:..:.:::.:|.||||::|.|||:.||||:.:....:...:.|.||.::||:|...|.||.|
 Worm   204 ASSISAASVATVMTQPLDVMKTRMMNAAPGEFKGILDCFMFTAKLGPMGFFKGFIPAWARLAPHT 268

  Fly   278 TLLFVLYEQLRLHFG 292
            .|.|:.:|||||.||
 Worm   269 VLTFIFFEQLRLKFG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 104/263 (40%)
Mito_carr 26..100 CDD:278578 27/74 (36%)
Mito_carr 104..201 CDD:278578 44/97 (45%)
Mito_carr 211..292 CDD:278578 33/80 (41%)
slc-25A10NP_509133.1 PTZ00169 3..279 CDD:240302 108/269 (40%)
Mito_carr 15..91 CDD:278578 28/75 (37%)
Mito_carr 95..193 CDD:278578 43/97 (44%)
Mito_carr 214..283 CDD:278578 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.