DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and ucp-4

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:302 Identity:77/302 - (25%)
Similarity:135/302 - (44%) Gaps:47/302 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CVAFAVA-----PIDIVKTHMQIQRQKRSILGTVKRIHSL---KGYLGFYDGFSAAILRQMTSTN 88
            |.|..||     |:||.||.:||.|.|.:..|.|:..:.:   :|.:..:.|.:.||.|....|.
 Worm    31 CTAALVAETVTYPLDITKTRLQIARNKFTKGGMVQVTYDIIRREGAMALWTGVAPAITRHYIYTG 95

  Fly    89 IHFIVYDTGKKMEY---VDRDSYLGKIILGCVAGACGSAFGI-------PTDLINVRMQTD---- 139
            |....|:..:.:.:   |::...|.|.:|      ||:..|:       ||||:.|:||.:    
 Worm    96 IRMGAYEQIRLLTFNKEVEKSFPLWKSML------CGAFSGLIAQFAASPTDLVKVQMQMEGLRR 154

  Fly   140 MKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISV 204
            :::.|.:.......|..|.|   .:|:..|:.|......:::|...:.||.||.:|..:..|..:
 Worm   155 LQKQPLRYTGATDCFRSLYR---TQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNFEL 216

  Fly   205 NDGLPLHFLTSLGTSIISSAITHPLDVVRTIMM---------------NSRPGEFRTVFQASVHM 254
            .|....|.:.|....:.::.::.|.|||:|.||               |:....::.|....:.:
 Worm   217 KDNWLTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKI 281

  Fly   255 MR-FGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHFGICS 295
            :: .|....|:||:|:.:|.||.:...:|.||::|...|..|
 Worm   282 IKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEIRKWTGASS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 74/293 (25%)
Mito_carr 26..100 CDD:278578 23/75 (31%)
Mito_carr 104..201 CDD:278578 26/107 (24%)
Mito_carr 211..292 CDD:278578 23/96 (24%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 74/294 (25%)
Mito_carr 22..111 CDD:278578 23/79 (29%)
Mito_carr 115..214 CDD:278578 26/107 (24%)
Mito_carr <240..318 CDD:278578 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.