DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Slc25a10

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:283 Identity:110/283 - (38%)
Similarity:165/283 - (58%) Gaps:9/283 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQ-KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            |....||:|||.||...|....|:|::|.|:|.|:: |..:.|...::....|:|..|:|.||::
  Rat     3 EARTSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALYNGLSASL 67

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRDS-----YLGKIILGCVAGACGSAFGIPTDLINVRMQTDM 140
            .||||.:...|.:|:|.:  :|:.:||     :..|::||.::|..|...|.|.||:|||||.||
  Rat    68 CRQMTYSLTRFAIYETMR--DYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDM 130

  Fly   141 KEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVN 205
            |.|..:||||.|..|||.|:.:|||.|.|:.|.::|..:.:|.|..|::.||..|..|.....::
  Rat   131 KLPLSQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLS 195

  Fly   206 DGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPTI 270
            |.:..|||:|......::.:..||||::|.:|||: ||::.||..:|...:.|....::|.||..
  Rat   196 DNIFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAVETAKLGPQAFFKGLVPAG 259

  Fly   271 VRKAPATTLLFVLYEQLRLHFGI 293
            ||..|.|.|.|:..||||.||||
  Rat   260 VRLVPHTVLTFMFLEQLRKHFGI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 100/267 (37%)
Mito_carr 26..100 CDD:278578 26/74 (35%)
Mito_carr 104..201 CDD:278578 43/101 (43%)
Mito_carr 211..292 CDD:278578 32/80 (40%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 27/81 (33%)
Mito_carr 94..189 CDD:395101 40/94 (43%)
Mito_carr 197..283 CDD:395101 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.