DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and SLC25A10

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:178 Identity:69/178 - (38%)
Similarity:103/178 - (57%) Gaps:8/178 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQ-KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            |..:.||:|||.||...|....|:|::|.|:|.|:: |..:.|...|:....|.|..|.|.||::
Human     4 EARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASL 68

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRDS-----YLGKIILGCVAGACGSAFGIPTDLINVRMQTDM 140
            .||||.:...|.:|:|.:  :.|.:.|     :..|::||.|:|..|...|.|.||:|||||.|:
Human    69 CRQMTYSLTRFAIYETVR--DRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDV 131

  Fly   141 KEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQI 188
            |.|..:||||.|..|||.|:.:|||.:.|:.|.::|..:.:|.|..|:
Human   132 KLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 65/169 (38%)
Mito_carr 26..100 CDD:278578 27/74 (36%)
Mito_carr 104..201 CDD:278578 37/90 (41%)
Mito_carr 211..292 CDD:278578
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 28/81 (35%)
Mito_carr 95..179 CDD:278578 35/83 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.