DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and ucp3

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_002942565.1 Gene:ucp3 / 100495495 XenbaseID:XB-GENE-6464668 Length:309 Species:Xenopus tropicalis


Alignment Length:279 Identity:82/279 - (29%)
Similarity:140/279 - (50%) Gaps:18/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGFASMCVA-FAVAPIDIVKTHMQIQRQKRS-----------ILGTVKRIHSLKGYLGFYDGFSA 78
            |...:.|:| ....|:|..|..:|||.:..|           :.||:|.:...:|....|:|..|
 Frog    19 GAGTAACIADLFTFPLDTAKVRLQIQGEGTSVKDTKVLRYKGVFGTIKTMVKTEGATSLYNGLVA 83

  Fly    79 AILRQMTSTNIHFIVYDTGKKMEYVDRDSYLG---KIILGCVAGACGSAFGIPTDLINVRMQTDM 140
            .:.|||:..:|...:||:.|:. |..:....|   :::.||..||.......|||::.||.|..:
 Frog    84 GLQRQMSFASIRIGLYDSVKQF-YCRQSESSGVACRLLAGCTTGAMAVTLAQPTDVVKVRFQAHI 147

  Fly   141 KEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVN 205
            |....:|| |....|....|.||||.:.|:||....:.::::..|:::..||:||..:.....:.
 Frog   148 KVMDGERR-YNGTVDAYKTIAKEEGLRGLWKGTIANITRNAIVNCAELVTYDLIKETILNQRLMT 211

  Fly   206 DGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQ-ASVHMMRFGVMGPYRGFVPT 269
            |.||.||:.:.|....::.:..|:|||:|..|||..|:::.... |.:.:::.|.:..|:||:|.
 Frog   212 DNLPCHFVAAFGAGFCATVVASPVDVVKTRYMNSPAGQYKNALNCAFIMLVKEGSVAFYKGFMPA 276

  Fly   270 IVRKAPATTLLFVLYEQLR 288
            .:|......::||.||||:
 Frog   277 FLRLGSWNIVMFVSYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 81/277 (29%)
Mito_carr 26..100 CDD:278578 24/85 (28%)
Mito_carr 104..201 CDD:278578 29/99 (29%)
Mito_carr 211..292 CDD:278578 25/79 (32%)
ucp3XP_002942565.1 PTZ00169 14..299 CDD:240302 82/279 (29%)
Mito_carr 111..206 CDD:395101 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.