DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and SLC25A27

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens


Alignment Length:298 Identity:66/298 - (22%)
Similarity:119/298 - (39%) Gaps:49/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GVAGAIAQCFTAPFDLIEARMVVIKKD---------------RGMASNLQQAIRTHGFISLYDGL 71
            |.|..:|:..|.|.||.:.|:.:..:.               |||.......|...||:.|:.|:
Human    27 GCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGV 91

  Fly    72 SAQLLRQLTYTSMRFHLYE------MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRM 130
            :..:.|.:.|:..|...||      .||.. |:...|...|:...:||.:...:..|.:|:..:|
Human    92 TPAIYRHVVYSGGRMVTYEHLREVVFG
KSE-DEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQM 155

  Fly   131 QVNRALPKETR-WNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAE 194
            |:......|.: ..:|.|.....::..|.|...|::|...:..|::|:.:.....||..|. |..
Human   156 QMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKH-YLV 219

  Fly   195 FFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINS------------------ 241
            ......||.:.|.:||:.:..|...:..|.:       |...|::|.                  
Human   220 LNTPLEDNIMTHGLSSLCSGLVASILGTPAD-------VIKSRIMNQPRDKQGRGLLYKSSTDCL 277

  Fly   242 ISYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
            |..:...|....::|.:|..|||.|.:::.:|::|::|
Human   278 IQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 23/94 (24%)
Mito_carr 98..192 CDD:395101 20/94 (21%)
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 21/90 (23%)
Solcar 1 21..115 21/87 (24%)
Mito_carr 125..219 CDD:365909 21/94 (22%)
Solcar 2 125..217 20/92 (22%)
Solcar 3 226..317 21/97 (22%)
Mito_carr 227..317 CDD:365909 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.