DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and SLC25A14

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001269126.1 Gene:SLC25A14 / 9016 HGNCID:10984 Length:353 Species:Homo sapiens


Alignment Length:321 Identity:79/321 - (24%)
Similarity:135/321 - (42%) Gaps:77/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDL-----------IEARMVVIKKDRGMASNLQQAIRTHGFISLYDGLSAQ 74
            ||:|..:|:..|.|.||           |:||...||. |||...|.:..:..|.::||.|::..
Human    44 GGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKY-RGMFHALFRICKEEGVLALYSGIAPA 107

  Fly    75 LLRQLTYTSMRFHLYEMGK----EHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRA 135
            ||||.:|.:::..:|:..|    |.|:|.. ||..::...::|.::..:..|.:::..|||...:
Human   108 LLRQASYGTIKIGIYQSLKRLFVERLEDET-LLINMICGVVSGVISSTIANPTDVLKIRMQAQGS 171

  Fly   136 LPKETRWNYRNVFDG-----LYRVTREEG--------FTKLYSGCFLSFM--------------R 173
            |           |.|     ...:.::||        .:|..:||.|..|              .
Human   172 L-----------FQGSMIGSFIDIYQQEGTRGLWRCLCSKAVTGCVLWLMPVIPALWEANAGGSL 225

  Fly   174 SSLITISQNAA---------YDQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRY 229
            ..::..:|.||         ||..|: :.....|..|..|.|.:||.|..........|::.:| 
Human   226 EGVVPTAQRAAIVVGVELPVYDITKK-HLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVR- 288

  Fly   230 LRMVDSRRL----------INSISYMMRF-GSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
            .||::.|.:          ::.|..|.:. |....::|..|..||:.|..:|.|:::|||:
Human   289 TRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/89 (33%)
Mito_carr 98..192 CDD:395101 24/129 (19%)
SLC25A14NP_001269126.1 Mito_carr 37..133 CDD:278578 29/89 (33%)
PTZ00169 41..351 CDD:240302 79/321 (25%)
Mito_carr 134..254 CDD:278578 24/132 (18%)
Mito_carr 262..351 CDD:278578 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.