DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a14

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus


Alignment Length:294 Identity:75/294 - (25%)
Similarity:132/294 - (44%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVV--------IK--KDRGMASNLQQAIRTHGFISLYDGLSAQL 75
            ||:|..:|:..|.|.||.:.|:.|        .|  |.|||...|.:..|..|.::||.|::..|
  Rat    66 GGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYREEGILALYSGIAPAL 130

  Fly    76 LRQLTYTSMRFHLYEMGK----EHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRAL 136
            |||.:|.:::..:|:..|    |.|:|.. ||..::...::|.::..:..|.:::..|||...:|
  Rat   131 LRQASYGTIKIGIYQSLKRLFVERLEDET-LLINMICGVVSGVISSTIANPTDVLKIRMQAQGSL 194

  Fly   137 PKETRWNYRNVFDG-----LYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFF 196
                       |.|     ...:.::||...|:.|...:..|::::...:...||..|:      
  Rat   195 -----------FQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKK------ 242

  Fly   197 H-----MKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLI----------NSISYMM 246
            |     |..|..|.|.:||.|..........|::.:| .||::.|.::          :.|..|.
  Rat   243 HLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVR-TRMMNQRAIVGHVDLYKGTLDGILKMW 306

  Fly   247 RF-GSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
            :. |....::|..|..||:.|..:|.|:::|||:
  Rat   307 KHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/88 (33%)
Mito_carr 98..192 CDD:395101 19/98 (19%)
Slc25a14XP_006257593.1 PTZ00169 63..342 CDD:240302 75/294 (26%)
Mito_carr 253..342 CDD:395101 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.