DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and DIC1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:89/283 - (31%)
Similarity:140/283 - (49%) Gaps:21/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KKIRPRWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDR-GMASNLQQAIRTHGFISLYDGLSAQL 75
            |.|:..||.||.||..|...|.|.||.:.|:......: .:...|:..:...|.:.||.||||.:
Yeast    11 KNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAV 75

  Fly    76 LRQLTYTSMRFHLYEMGKEH------LDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNR 134
            |||.|||::||..|::.||:      |.:.|.||.   .:..:|.:.|:.|...:::|.|||.:.
Yeast    76 LRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLP---CSMFSGAIGGLAGNFADVVNIRMQNDS 137

  Fly   135 ALPKETRWNYRNVFDGLYRVTREEGFTK-LYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHM 198
            ||....|.||:|..||:|::.|.||..| |::|...:.:|..|:|.||...||..|.........
Yeast   138 ALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDF 202

  Fly   199 KHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMV----DSRRLINSISYMMRFGSRGP---FRG 256
            .......||.:|:.|..|...:..|.:.:: .|::    |.:..:..::..:|  ..||   |||
Yeast   203 DASKNYTHLTASLLAGLVATTVCSPADVMK-TRIMNGSGDHQPALKILADAVR--KEGPSFMFRG 264

  Fly   257 MVPYVLRMVPNTVITFLSFEQLR 279
            .:|...|:.|.|::.|.:.|||:
Yeast   265 WLPSFTRLGPFTMLIFFAIEQLK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/82 (35%)
Mito_carr 98..192 CDD:395101 33/94 (35%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 27/73 (37%)
Mito_carr 100..200 CDD:395101 34/102 (33%)
Mito_carr 203..289 CDD:395101 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 1 1.010 - - QHG51917
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.760

Return to query results.
Submit another query.