DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and DIC3

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:322 Identity:86/322 - (26%)
Similarity:139/322 - (43%) Gaps:64/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVV-----IKKDRGMASNLQ------------------------ 56
            ||:|..||...|.|.|||:.||.:     ...|:....||.                        
plant     9 GGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLIGSIS 73

  Fly    57 ------------------------QAIRTHGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLD 97
                                    ..::|.|..:|:.|:||.:|||:.|::.|..:|:..|....
plant    74 LLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIYDFLKRRWT 138

  Fly    98 DPA----GLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREE 158
            |..    .|:.|:....:||.|..|||.|.::...|||.:.:||...|.||::|.|.:.|:.|:|
plant   139 DQLTGNFPLVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRRNYKSVVDAIDRIARQE 203

  Fly   159 GFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKP 223
            |.:.|:.|.:|:..|:.::|.||.|.||..|:|..............|:.:|..|..|......|
plant   204 GVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAGGRGTPGGIGTHVAASFAAGIVAAVASNP 268

  Fly   224 IENLRYLRMVDSRRLIN------SISYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
            |:.:: .||:::.:.|.      ::..:...|....::|:||...|..|.|:|.||:.||:|
plant   269 IDVVK-TRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFLTLEQVR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 28/127 (22%)
Mito_carr 98..192 CDD:395101 35/97 (36%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 23/119 (19%)
Mito_carr 143..238 CDD:395101 35/94 (37%)
Mito_carr 251..336 CDD:395101 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.