DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and DIC2

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:307 Identity:89/307 - (28%)
Similarity:140/307 - (45%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARM-----------VVIKKDRGMASNLQQA---------------- 58
            ||:|..||.|.|.|.|||:.|:           |.:.:......|...|                
plant     9 GGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPKVGPIS 73

  Fly    59 -----IRTHGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLDDP-AGLLD---KVLVAALAGC 114
                 :::.|..:|:.|:||.||||..|::.|..|||:.|....|| :|.|:   |:....:||.
plant    74 LGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKWTD
PESGKLNLSRKIGAGLVAGG 138

  Fly   115 VAGVVGTPMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITI 179
            :...||.|.::...|||.:..||...|.||..|.|.:..:.:.||.|.|:.|..|:..|:.::|.
plant   139 IGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMIVTA 203

  Fly   180 SQNAAYDQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLIN---- 240
            :|.|:|||.|:...|...| :|....|:::|..|.||......|::       |...|::|    
plant   204 AQLASYDQFKEGILENGVM-NDGLGTHVVASFAAGFVASVASNPVD-------VIKTRVMNMKVG 260

  Fly   241 --------SISYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
                    ::..:...|:...::|.||.|.|..|.||:.|::.||:|
plant   261 AYDGAWDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 30/106 (28%)
Mito_carr 98..192 CDD:395101 34/97 (35%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 30/108 (28%)
Mito_carr 122..220 CDD:395101 33/97 (34%)
Mito_carr 225..312 CDD:395101 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.