DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and PUMP1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:276 Identity:70/276 - (25%)
Similarity:122/276 - (44%) Gaps:22/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AGAIAQCFTAPFDLIEARM----------VVIKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQ 78
            |..:.:..|.|.|..:.|:          |.:.|.||:...:....|..|..||:.|:...|.||
plant    21 AACVGEVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQ 85

  Fly    79 LTYTSMRFHLYE------MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALP 137
            ..:..:|..:||      :||:.:.| ..|..|:|.....|.:..:|..|.:|:..|:|....|.
plant    86 CLFGGLRIGMYEPVKNLYVGK
DFVGD-VPLSKKILAGLTTGALGIMVANPTDLVKVRLQAEGKLA 149

  Fly   138 KETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDN 202
            ......|....:....:.|:||...|::|...:..|:::|..::.|:|||.|:...:..... ||
plant   150 AGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKETILKIPGFT-DN 213

  Fly   203 TLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSIS-YMMRFGSRGP---FRGMVPYVLR 263
            .:.|::|.:.|.|....|..|::.::...|.||.....:|. ::....|.||   ::|.:|...|
plant   214 VVTHILSGLGAGFFAVCIGSPVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNFGR 278

  Fly   264 MVPNTVITFLSFEQLR 279
            :....||.||:.||.:
plant   279 LGSWNVIMFLTLEQAK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 22/87 (25%)
Mito_carr 98..192 CDD:395101 24/93 (26%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 20/84 (24%)
Mito_carr 110..206 CDD:395101 24/96 (25%)
Mito_carr 210..299 CDD:395101 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.