DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and UCP5

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:306 Identity:90/306 - (29%)
Similarity:142/306 - (46%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQA-------------------------IR 60
            ||:|..:|.|.|.|.|||:.||.:..:...:.:||:.|                         ||
plant     9 GGIASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPALAFQTSTTVNAPPLRVGVIGVGSRLIR 73

  Fly    61 THGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLDDP----AGLLDKVLVAALAGCVAGVVGT 121
            ..|..:|:.|:||.:|||..|::.|..||::.|....||    ..|:.|:...|:||.:...||.
plant    74 EEGMRALFSGVSATVLRQTLYSTTRMGLYDIIK
GEWTDPETKTMPLMKKIGAGAIAGAIGAAVGN 138

  Fly   122 PMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYD 186
            |.::...|||.:..||...|.||::|.|.:.::.|.||.|.|:.|..|:..|:.|:|.||.|:||
plant   139 PADVAMVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQLASYD 203

  Fly   187 QAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLR---------------YLRMVDSR 236
            ..|:...|...:| |....|:.:|..|.||......|::.::               |...||. 
plant   204 SVKETILEKGLLK-DGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMKVVAGVAPPYKGAVDC- 266

  Fly   237 RLINSISYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNF 282
                ::..:...|....::|.:|.|.|..|.||:.|::.||::..|
plant   267 ----ALKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKKLF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 30/99 (30%)
Mito_carr 98..192 CDD:395101 36/97 (37%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 29/96 (30%)
Mito_carr <136..213 CDD:395101 30/76 (39%)
Mito_carr 216..311 CDD:395101 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.