DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and ucp3

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_956647.2 Gene:ucp3 / 794081 ZFINID:ZDB-GENE-040426-1317 Length:309 Species:Danio rerio


Alignment Length:303 Identity:72/303 - (23%)
Similarity:132/303 - (43%) Gaps:43/303 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKTKKIRP----RWWSGGVAGAIAQCFTAPFDLIEARMVV-----------IKKDRGMASNLQQA 58
            ||...:.|    :::..|.|...|...|.|.|..:.|:.:           :.|.||:...:...
Zfish     4 IKPTDLPPTAAVKFFGAGTAACFADLVTFPLDTAKVRLQIQGESGTAPGSAVLKYRGVFGTITTM 68

  Fly    59 IRTHGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHL---DDPAGLLDKVLVAALAGCVAGVVG 120
            :||.|..|||:||.|.|.||:::.|:|..||:..|:..   .:.|.::.::|.....|.:|....
Zfish    69 VRTEGARSLYNGLVAGLQRQMSFASVRIGLYDSMKQFYTRGSENASIVTRLLAGCTTGAMAVAFA 133

  Fly   121 TPMELINTRMQVNRALPKETRW--NYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNA 183
            .|.:::..|.|   |..:.|..  .|....|....:.|:||...|:.||..:..|::::..::..
Zfish   134 QPTDVVKVRFQ---AQVRHTDGGKRYNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCAELV 195

  Fly   184 AYDQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSIS----- 243
            .||..|.:..: :.:..||...|..::..|.|....:..|::       |...|.:||.:     
Zfish   196 TYDIIKDLILK-YDLMTDNLPCHFTAAFGAGFCTTIVASPVD-------VVKTRFMNSSAGQYGS 252

  Fly   244 ----YMMRFGSRGP---FRGMVPYVLRMVPNTVITFLSFEQLR 279
                .:|.....||   ::|.:|..||:....::.|:|:||::
Zfish   253 ALNCALMMLTKEGPAAFYKGFMPSFLRLGSWNIVMFVSYEQIK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 27/86 (31%)
Mito_carr 98..192 CDD:395101 21/95 (22%)
ucp3NP_956647.2 Mito_carr 10..110 CDD:278578 28/99 (28%)
PTZ00169 14..298 CDD:240302 69/293 (24%)
Mito_carr 114..207 CDD:278578 20/96 (21%)
Mito_carr 211..301 CDD:278578 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.