DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and UCP1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:289 Identity:82/289 - (28%)
Similarity:133/289 - (46%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WSGGVAGAIAQCFTAPFDLIEARMVV--------IKKDRGMASNLQQAIRTHGFISLYDGLSAQL 75
            :|.|:|..:|...|.|.|..:.|:.|        :.:.:|:...:...::|.|.:.||.||.|.|
Human    18 FSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGL 82

  Fly    76 LRQLTYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRAL 136
            .||::..|:|..||:..:|.|    :....|..|:|.....|.||..:|.|.|::..|:|....|
Human    83 QRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHL 147

  Fly   137 ----PKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFH 197
                |:     |...::....:...||.|.|:.|...:.|||.:|..::...||..|:.:.: .:
Human   148 HGIKPR-----YTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVK-NN 206

  Fly   198 MKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSI--SY-------MMRFGSRGP 253
            :..|:...||:|::.|.|....:..|::       |...|.|||.  .|       |..|.:.||
Human   207 ILADDVPCHLVSALIAGFCATAMSSPVD-------VVKTRFINSPPGQYKSVPNCAMKVFTNEGP 264

  Fly   254 ---FRGMVPYVLRMVPNTVITFLSFEQLR 279
               |:|:||..||:....||.|:.||||:
Human   265 TAFFKGLVPSFLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 25/83 (30%)
Mito_carr 98..192 CDD:395101 26/97 (27%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 25/85 (29%)
Solcar 1 11..102 24/83 (29%)
Mito_carr 111..206 CDD:278578 26/100 (26%)
Solcar 2 111..201 26/94 (28%)
Solcar 3 210..295 30/91 (33%)
Mito_carr 215..300 CDD:278578 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.