DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a11

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_077173.1 Gene:Slc25a11 / 67863 MGIID:1915113 Length:314 Species:Mus musculus


Alignment Length:277 Identity:92/277 - (33%)
Similarity:142/277 - (51%) Gaps:20/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVI---KKDRGMASN---LQQAIRTHGFISLYDGLSAQLLRQL 79
            ||:||..|..|..|.||::.||.:.   .|.|...::   |...::|.|...:|.||||.||||.
Mouse    28 GGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKTEGLKGIYTGLSAGLLRQA 92

  Fly    80 TYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKET 140
            |||:.|..:|.:..|.|    ..|.|.|.|.|:...||.....||||.|:...||..:..||.:.
Mouse    93 TYTTTRLGIYTVLFER
LTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQ 157

  Fly   141 RWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLL 205
            |..|:|||:.|.|:.||||...|:.||..:..|:.::..:|.|:|.|:||...:..:.. ||.|.
Mouse   158 RRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFS-DNILC 221

  Fly   206 HLISSVTAAFVCGPIIKPIE----NLRYLRMVDSR-RLINSISYMMRF----GSRGPFRGMVPYV 261
            |..:|:.:..|......|::    .::.:||:|.: ...|.:..:::.    |....::|..||.
Mouse   222 HFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYY 286

  Fly   262 LRMVPNTVITFLSFEQL 278
            .|:.|:||:||:..||:
Mouse   287 ARLGPHTVLTFIFLEQM 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 31/80 (39%)
Mito_carr 98..192 CDD:395101 37/93 (40%)
Slc25a11NP_077173.1 Solcar 1 23..108 30/79 (38%)
Mito_carr 24..102 CDD:278578 29/73 (40%)
Mito_carr 116..213 CDD:278578 37/96 (39%)
Solcar 2 117..208 35/90 (39%)
Mito_carr 215..309 CDD:278578 23/90 (26%)
Solcar 3 217..306 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.