DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a30

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:266 Identity:63/266 - (23%)
Similarity:114/266 - (42%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVIKKD----------RGMASNLQQAIRTHGFISLYDGLSAQL 75
            ||:|...|:|.|.|.||.:.|:.:..:.          |||...|.:..|..|..:||.|::..:
Mouse    12 GGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIAPAM 76

  Fly    76 LRQLTYTSMRFHLYE----MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRAL 136
            |||.:|.:::...|:    :..|..:|.. ||..|:...|:|.::..:..|.:::..|||...:.
Mouse    77 LRQASYGTIKIGTYQSLKRL
AVERPEDET-LLVNVVCGILSGVISSAIANPTDVLKIRMQAQNSA 140

  Fly   137 PKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKH- 200
            .:      ..:.|....:.::||...|:.|..|:..|::::...:...||..|         || 
Mouse   141 VQ------GGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITK---------KHL 190

  Fly   201 -------DNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSISYMMRFGSRGPFRGMV 258
                   |....|.:||.|...|......|::.:| .||::.|.|        |.|....::|.:
Mouse   191 ILSGLMGDTVATHFLSSFTCGLVGALASNPVDVVR-TRMMNQRAL--------RDGRCAGYKGTL 246

  Fly   259 PYVLRM 264
            ..:|::
Mouse   247 DCLLQV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 25/88 (28%)
Mito_carr 98..192 CDD:395101 20/93 (22%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 24/83 (29%)
Mito_carr 105..191 CDD:365909 21/101 (21%)
Mito_carr 199..>259 CDD:365909 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.