DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a11

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_071793.2 Gene:Slc25a11 / 64201 RGDID:708476 Length:314 Species:Rattus norvegicus


Alignment Length:277 Identity:91/277 - (32%)
Similarity:141/277 - (50%) Gaps:20/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVI---KKDRGMASN---LQQAIRTHGFISLYDGLSAQLLRQL 79
            ||:||..|..|..|.||::.||.:.   .|.|...::   |...::..|...:|.||||.||||.
  Rat    28 GGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQA 92

  Fly    80 TYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKET 140
            |||:.|..:|.:..|.|    ..|.|.|.|.|:...||.....||||.|:...||..:..||.:.
  Rat    93 TYTTTRLGIYTVLFER
LTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQ 157

  Fly   141 RWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLL 205
            |..|:|||:.|.|:.||||...|:.||..:..|:.::..:|.|:|.|:||...:..:.. ||.|.
  Rat   158 RRGYKNVFNALIRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFS-DNILC 221

  Fly   206 HLISSVTAAFVCGPIIKPIE----NLRYLRMVDSR-RLINSISYMMRF----GSRGPFRGMVPYV 261
            |..:|:.:..|......|::    .::.:||:|.: ...|.:..:::.    |....::|..||.
  Rat   222 HFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYY 286

  Fly   262 LRMVPNTVITFLSFEQL 278
            .|:.|:||:||:..||:
  Rat   287 ARLGPHTVLTFIFLEQM 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 30/80 (38%)
Mito_carr 98..192 CDD:395101 37/93 (40%)
Slc25a11NP_071793.2 Solcar 1 23..108 29/79 (37%)
Mito_carr 24..102 CDD:395101 28/73 (38%)
Mito_carr 116..213 CDD:395101 37/96 (39%)
Solcar 2 117..208 35/90 (39%)
Mito_carr 215..313 CDD:395101 23/90 (26%)
Solcar 3 217..306 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.