DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and slc25a11

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001025683.1 Gene:slc25a11 / 595075 XenbaseID:XB-GENE-979673 Length:305 Species:Xenopus tropicalis


Alignment Length:279 Identity:87/279 - (31%)
Similarity:139/279 - (49%) Gaps:24/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVV------IKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQL 79
            ||:||..|..|..|.||::.||.:      .|:.:.....:...:|..|...:|.||||.||||.
 Frog    19 GGLAGMGATVFVQPLDLVKNRMQLSGEGAKTKEYKTSFHAVGSILRNEGLRGIYTGLSAGLLRQA 83

  Fly    80 TYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKET 140
            |||:.|..:|.:..|..    ..|...|.|..:...||.....||||.|:...||..:..:|.:.
 Frog    84 TYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTPAEVALIRMTADGRMPVDQ 148

  Fly   141 RWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAE--FFHMKHDNT 203
            |..|.|||:.|.|::||||.|.|:.||..:..|:.::..:|.|:|.|:||...:  :|   .|:.
 Frog   149 RRGYTNVFNALVRMSREEGITTLWRGCVPTMARAVVVNAAQLASYSQSKQFLLDTGYF---GDDI 210

  Fly   204 LLHLISSVTAAFVCGPIIKPIE----NLRYLRMVDSR-RLINSISYMMRF----GSRGPFRGMVP 259
            |.|..:|:.:..|......|::    .::.:||:|.: ...|.:..:::.    |....::|..|
 Frog   211 LCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTP 275

  Fly   260 YVLRMVPNTVITFLSFEQL 278
            |..|:.|:||:||:..||:
 Frog   276 YYARLGPHTVLTFIFLEQM 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/80 (36%)
Mito_carr 98..192 CDD:395101 35/93 (38%)
slc25a11NP_001025683.1 PTZ00169 13..296 CDD:240302 87/279 (31%)
Mito_carr 13..93 CDD:278578 27/73 (37%)
Mito_carr 107..202 CDD:278578 35/94 (37%)
Mito_carr 210..302 CDD:278578 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.