DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and slc25a10

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 / 549772 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis


Alignment Length:289 Identity:112/289 - (38%)
Similarity:165/289 - (57%) Gaps:37/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RWWSGGVAGAIAQCFTAPFDLI----EARMVVIKKDRGMASNLQQAIRTHGFISLYDGLSAQLLR 77
            ||:.||:|...|.|.|.|.|||    :.:..|..:..|||.::   ||..||::||:||||.|.|
 Frog     8 RWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISV---IRNDGFLALYNGLSASLFR 69

  Fly    78 QLTYTSMRFHLYEMGKEHL--DDPAGL--LDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPK 138
            |:||:..||.:||..::.|  |:.|.|  ..|||:.|:.|...|.:|||.:::|.|||.:..||.
 Frog    70 QITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKLPA 134

  Fly   139 ETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNT 203
            ..|.||.:..||::||.|||||.||:||..::..|.:|:|:.|.|.||||||:......:. ||.
 Frog   135 HLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLS-DNI 198

  Fly   204 LLH-LISSVT---AAFVCGPIIKPIENLRYLRMVDSRRLINS-------ISYMMRFGSRGP---F 254
            ..| |.||:.   |.|:|    :|::.|:       .||:|:       :...:.....||   :
 Frog   199 FTHFLASSIAGGCATFLC----QPLDVLK-------TRLMNAKGEYRGVVHCTLETAKLGPLAFY 252

  Fly   255 RGMVPYVLRMVPNTVITFLSFEQLRVNFG 283
            :|:||..:|::|:||:||:..||||..||
 Frog   253 KGLVPAGIRLIPHTVLTFVFLEQLRKYFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 33/79 (42%)
Mito_carr 98..192 CDD:395101 44/95 (46%)
slc25a10NP_001017018.1 Mito_carr 12..89 CDD:365909 33/79 (42%)
Mito_carr 96..190 CDD:365909 43/93 (46%)
Mito_carr 197..281 CDD:365909 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.