DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Ucp2

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_062227.2 Gene:Ucp2 / 54315 RGDID:3932 Length:309 Species:Rattus norvegicus


Alignment Length:294 Identity:73/294 - (24%)
Similarity:129/294 - (43%) Gaps:45/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQA------------IRTHGFISLYD 69
            ::...|.|..||...|.|.|..:.|:.:..:.:|:|.....|            :||.|..|||:
  Rat    16 KFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYRGVLGTILTMVRTEGPRSLYN 80

  Fly    70 GLSAQLLRQLTYTSMRFHLYE-------MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELIN 127
            ||.|.|.||:::.|:|..||:       .|.||    ||:..::|..:..|.:|..|..|.:::.
  Rat    81 GLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEH----AGIGSRLLAGSTTGALAVAVAQPTDVVK 141

  Fly   128 TRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIY 192
            .|.|.........|  |::..:....:.||||...|:.|...:..|::::..::...||..|...
  Rat   142 VRFQAQARAGGGRR--YQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCTELVTYDLIKDTL 204

  Fly   193 AEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINS------------ISYM 245
            .: .::..|:...|..|:..|.|....|..|::       |...|.:||            ::.:
  Rat   205 LK-ANLMTDDLPCHFTSAFGAGFCTTVIASPVD-------VVKTRYMNSALGQYHSAGHCALTML 261

  Fly   246 MRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
            .:.|.|..::|.:|..||:....|:.|:::|||:
  Rat   262 RKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/94 (31%)
Mito_carr 98..192 CDD:395101 21/93 (23%)
Ucp2NP_062227.2 Mito_carr 10..111 CDD:395101 27/94 (29%)
Solcar 1 11..106 27/89 (30%)
Mito_carr 112..206 CDD:395101 23/99 (23%)
Solcar 2 114..203 21/90 (23%)
Solcar 3 212..297 22/91 (24%)
Mito_carr 217..299 CDD:395101 21/86 (24%)
Purine nucleotide binding. /evidence=ECO:0000250 276..298 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.