powered by:
Protein Alignment CG6893 and rangrf
DIOPT Version :9
Sequence 1: | NP_001369058.1 |
Gene: | CG6893 / 40038 |
FlyBaseID: | FBgn0036807 |
Length: | 291 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002941865.3 |
Gene: | rangrf / 496602 |
XenbaseID: | XB-GENE-5760490 |
Length: | 238 |
Species: | Xenopus tropicalis |
Alignment Length: | 43 |
Identity: | 7/43 - (16%) |
Similarity: | 20/43 - (46%) |
Gaps: | 3/43 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 LYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLL 205
|::|.|.:.:......:|:.......::::| |...|.:::
Frog 59 LFAGAFSAVLPPFSQDVSELREIPDNQEVFA---HNATDQSII 98
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6893 | NP_001369058.1 |
Mito_carr |
20..96 |
CDD:395101 |
|
Mito_carr |
98..192 |
CDD:395101 |
4/28 (14%) |
rangrf | XP_002941865.3 |
Mog1 |
58..238 |
CDD:238137 |
7/43 (16%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.