DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and rangrf

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_002941865.3 Gene:rangrf / 496602 XenbaseID:XB-GENE-5760490 Length:238 Species:Xenopus tropicalis


Alignment Length:43 Identity:7/43 - (16%)
Similarity:20/43 - (46%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLL 205
            |::|.|.:.:......:|:.......::::|   |...|.:::
 Frog    59 LFAGAFSAVLPPFSQDVSELREIPDNQEVFA---HNATDQSII 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101
Mito_carr 98..192 CDD:395101 4/28 (14%)
rangrfXP_002941865.3 Mog1 58..238 CDD:238137 7/43 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.