DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and aralar1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:300 Identity:70/300 - (23%)
Similarity:120/300 - (40%) Gaps:52/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNL------------QQAIRTHGFISLYD 69
            |:..|..|||:......|.||::.||    :::...|.:            ::.:|..||:.||.
  Fly   357 RFTLGSFAGAVGATVVYPIDLVKTRM----QNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYR 417

  Fly    70 GLSAQLLRQLTYTSMRFHLYEMGKEHLDDPAGLLD---KVLVAALAGCVAGVVGTPMELINTRMQ 131
            ||..||:......:::..:.::.::.|.|..|.:.   :||....||....|...|:|::..|:|
  Fly   418 GLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQ 482

  Fly   132 VNRALPKETR---WNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYA 193
            |...:...::   |:          |.||.|...||.|.....:|....:......|...|.:.|
  Fly   483 VAGEIASGSKIRAWS----------VVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMA 537

  Fly   194 EFFHMKHDNTLL--HLISSVTAAFVCGP---------IIKPIENLRYLRMVDSRRLINSISYMMR 247
            :.....|..|||  ..|:.|.||.:..|         ::.......|..:.|:.:.|     |..
  Fly   538 DKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKI-----MAE 597

  Fly   248 FGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR----VNFG 283
            .|.|..::|....|.|..|...:|.:::|.|:    |:||
  Fly   598 EGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFYVDFG 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 19/87 (22%)
Mito_carr 98..192 CDD:395101 23/99 (23%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 22/94 (23%)
PTZ00169 358..631 CDD:240302 66/291 (23%)
Mito_carr 449..539 CDD:278578 23/99 (23%)
Mito_carr 544..633 CDD:278578 22/93 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.