DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG7943

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:178 Identity:44/178 - (24%)
Similarity:71/178 - (39%) Gaps:16/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQAIR----THGFISLYDGLSAQLLRQLTYTS 83
            |||: |:....||:.::. ::...|.....||.|.|.|    .||:..||.||.....|.....:
  Fly   150 VAGS-AESILLPFERVQT-LLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNA 212

  Fly    84 MRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGV-VGT---PMELINTRMQVNRALPKETRWN- 143
            :.|.|.|.....|.....:..:.:...:||.|.|. :.|   |:.:|...:|.......|..|. 
  Fly   213 LFFVLREEASVRLPKRK
SVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQA 277

  Fly   144 YRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQI 191
            .:.::     |.|:......|.||..:..||.:.....|.||:..|::
  Fly   278 CKRIY-----VERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 22/76 (29%)
Mito_carr 98..192 CDD:395101 21/99 (21%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578
Mito_carr 141..229 CDD:278578 23/80 (29%)
Mito_carr 235..322 CDD:278578 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.