DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and mfrn

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:296 Identity:69/296 - (23%)
Similarity:118/296 - (39%) Gaps:40/296 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDIRAKRVIKTKKIRPRWWSGGVAGAIAQCFTAPFDLIEARMVVIK---KDRGMASNLQQAIRTH 62
            |:|.....:.|..:.....:|.:||.:......|.|.::.||..:.   |:..:.|.|:..|...
  Fly     1 MNIDDYESLPTTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITRE 65

  Fly    63 GFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLDDPAGL--LDKVLVAALAGCVAGVVGTPMEL 125
            |.:....|.||.:|......|:.|..|||.||.......:  |:.|:..|:|..:...:.:|.::
  Fly    66 GLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNYVISGAVATLIHDAISSPTDV 130

  Fly   126 INTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQ 190
            |..|||:..:       .|.:|...:..:.:.|||.        :|.|:....:..|..|.....
  Fly   131 IKQRMQMYNS-------PYTSVVSCVRDIYKREGFK--------AFYRAYGTQLVMNLPYQTIHF 180

  Fly   191 IYAEFFHMKHD-----NTLLHLISSVTAAFVCGPIIKPIENLRYL----------RMVDSRRLIN 240
            ...|||..|.:     |..:|:.:...|......:..|::.::.|          .|:::.|.| 
  Fly   181 TTYEFFQNKMNLERKYNPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKI- 244

  Fly   241 SISYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFE 276
               |.|. |..|.|||....||..:|.|.|.:.::|
  Fly   245 ---YHMA-GPLGFFRGTTARVLYSMPATAICWSTYE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 23/78 (29%)
Mito_carr 98..192 CDD:395101 18/95 (19%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 22/84 (26%)
PTZ00168 17..280 CDD:185494 66/280 (24%)
Mito_carr 107..190 CDD:278578 21/97 (22%)
Mito_carr <215..282 CDD:278578 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.