DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and slc25a11

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001002099.1 Gene:slc25a11 / 415189 ZFINID:ZDB-GENE-040625-79 Length:308 Species:Danio rerio


Alignment Length:292 Identity:91/292 - (31%)
Similarity:143/292 - (48%) Gaps:28/292 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KTKKIRPRWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQ----------AIRTHGF 64
            ||.....::..||:||..|..|..|.||::.||.:    .|..|..::          .:|..|.
Zfish    11 KTSPKSIKFLFGGLAGMGATVFVQPLDLVKNRMQL----SGQGSKAREYKTSFHAVGSILRNEGV 71

  Fly    65 ISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLD----DPAGLLDKVLVAALAGCVAGVVGTPMEL 125
            ..:|.||||.||||.|||:.|..:|.:..|.:.    .|.....|.|:...||.....||||.|:
Zfish    72 RGIYTGLSAGLLRQATYTTTRLGIYTILFERMSKADGTPPNFFMKALIGMTAGATGAFVGTPAEV 136

  Fly   126 INTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQ 190
            ...||..:..||.:.|..|.|||:.|.|:|||||.|.|:.||..:..|:.::..:|.|:|.|:||
Zfish   137 ALIRMTADGRLPPDQRRGYTNVFNALVRITREEGVTTLWRGCIPTMARAVVVNAAQLASYSQSKQ 201

  Fly   191 IYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIE----NLRYLRMVDSRRLINS-----ISYMM 246
            ...:..:.: |:.|.|..:|:.:..|......|::    .::.:||:|.:...|:     :..:.
Zfish   202 ALLDSGYFR-DDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYNNGLDVLVKVIR 265

  Fly   247 RFGSRGPFRGMVPYVLRMVPNTVITFLSFEQL 278
            ..|....::|..||..|:.|:||:||:..||:
Zfish   266 NEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 30/85 (35%)
Mito_carr 98..192 CDD:395101 37/93 (40%)
slc25a11NP_001002099.1 Mito_carr 18..96 CDD:278578 28/81 (35%)
PTZ00169 19..300 CDD:240302 89/284 (31%)
Mito_carr 110..207 CDD:278578 37/96 (39%)
Mito_carr 213..305 CDD:278578 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.