DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG16736

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:260 Identity:64/260 - (24%)
Similarity:116/260 - (44%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AQCFTAPFDLIEARMV--VIKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQLTYTSMRFHLYE 90
            ||..:.|.:|:...|.  ||...|...:::.:.:..||....|.|:.|..||...:|...:.|: 
  Fly    13 AQLLSHPMELVRVNMQANVIHHSRLSINHMFRLMARHGLPGFYYGIVAACLRCTVHTMSTYTLF- 76

  Fly    91 MGKEHLDDPAGLL-----DKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWNYRNVFDG 150
               .:|.|...:|     :..:|..:.|...||:.||...:....|.:.......|.||||.:.|
  Fly    77 ---YNLQD
NKYVLMLQPYNTSMVLGITGFWGGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRG 138

  Fly   151 LYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLLHLISSVTAAF 215
            |..:..:.|||.|::|..::.:.|:.:.:......|:...:.: :||...:..|..||:......
  Fly   139 LKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVIS-WFHRLDEPWLSDLITMALTGS 202

  Fly   216 VCGPIIKPIENLRYLRMVDSRRL-INSISYMMR-----FGSRGPFRGMVPYVLRMVPNTVI-TFL 273
            :...|:.|::.|..|.:.:|... ..|..|:.|     .|.:|.|.|..|.::.::|:||: ||:
  Fly   203 IITVIMTPVDALATLTLNESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFV 267

  Fly   274  273
              Fly   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 17/69 (25%)
Mito_carr 98..192 CDD:395101 23/98 (23%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/71 (25%)
Mito_carr 187..277 CDD:278578 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.