DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG2616

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:235 Identity:57/235 - (24%)
Similarity:99/235 - (42%) Gaps:59/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWNYRN--------------------- 146
            |.:|:.|.....:.....||:::|.||||..:: |....:.|.|                     
  Fly    91 LQQVISACTGAMITACFMTPLDVIKTRMQSQQS-PAHKCFFYSNGLMDHLFASGPNGSELASLRQ 154

  Fly   147 ------VFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAK----QIYAEFF----- 196
                  .:|.|.:::|.||...|:||...:.:.:...||....||:|.|    |||...:     
  Fly   155 RPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQE 219

  Fly   197 --HMKHDNT------LLHLISSVTAAFVCGPIIKPIENLR---------YLRMVDSRRLINSISY 244
              |::..:|      ::.::|.|||......::.|||.:|         |.:|:...|.:.::. 
  Fly   220 PRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQ- 283

  Fly   245 MMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNFGY 284
                |..|.:||:.|.:||.||.:.|.:..:|.|:.|.|:
  Fly   284 ----GVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101
Mito_carr 98..192 CDD:395101 28/119 (24%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 27/116 (23%)
Mito_carr 230..321 CDD:278578 25/95 (26%)
Mito_carr 321..425 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.