DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Dic4

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:274 Identity:97/274 - (35%)
Similarity:156/274 - (56%) Gaps:8/274 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PRWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQLT 80
            ||||.||.|........||.|:::..|.:.::.|.:...:::.....|::..|||.||.:|||:|
  Fly    21 PRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMT 85

  Fly    81 YTSMRFHLYEMGK--EHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWN 143
            .|::.|.:|:.||  |::|..: .|.|:::..:||......|.|.:|||.|||.:...|...|.|
  Fly    86 STNIHFIVYDTGKKMEYVDRDS-YLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYKRRN 149

  Fly   144 YRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLLHLI 208
            |::|||||.|:.:|||:..||.|..::..:|||.|.||.|.||..|....:...: :|...||.:
  Fly   150 YKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISV-NDGLPLHFL 213

  Fly   209 SSVTAAFVCGPIIKPIENLRYLRM----VDSRRLINSISYMMRFGSRGPFRGMVPYVLRMVPNTV 269
            :|:..:.:...|..|::.:|.:.|    .:.|.:..:..:|||||..||:||.||.::|..|.|.
  Fly   214 TSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPTIVRKAPATT 278

  Fly   270 ITFLSFEQLRVNFG 283
            :.|:.:||||::||
  Fly   279 LLFVLYEQLRLHFG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 24/77 (31%)
Mito_carr 98..192 CDD:395101 38/93 (41%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 89/263 (34%)
Mito_carr 26..100 CDD:278578 23/73 (32%)
Mito_carr 104..201 CDD:278578 39/97 (40%)
Mito_carr 211..292 CDD:278578 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.