DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Mpcp2

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:223 Identity:56/223 - (25%)
Similarity:88/223 - (39%) Gaps:63/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ALAGCVAGVV--GT------PMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSG 166
            ||.| :.|::  ||      |::|:..|:||::|       .|:|:..|......|||...|..|
  Fly    63 ALCG-IGGILSCGTTHTFVVPLDLVKCRLQVDQA-------KYKNLVHGFKVTVAEEGARGLAKG 119

  Fly   167 CFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHD---NTLLHLISSVTAAFVCGPIIKPIENLR 228
            .|.:.:..|...:.:...|:..|..|||....::.   .|.|:|.:|.:|.|.....:.|.|   
  Fly   120 WFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFE--- 181

  Fly   229 YLRMVDSRRLINSI-SYMMRFGSRGP-----------FRGMVPYVLRMVPNTVITFLSF------ 275
                 .::..|.:| .|...|....|           ::|:||..:|.:|.|::.|..|      
  Fly   182 -----AAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVEL 241

  Fly   276 ----------------EQLRVNF--GYI 285
                            |||.|.|  |||
  Fly   242 LYKYVVPKPRADCTKGEQLIVTFAAGYI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101
Mito_carr 98..192 CDD:395101 24/89 (27%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 23/86 (27%)
Mito_carr <175..245 CDD:278578 15/77 (19%)
Mito_carr 260..338 CDD:278578 6/10 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.