DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and ucp2

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_989179.1 Gene:ucp2 / 394786 XenbaseID:XB-GENE-1010081 Length:307 Species:Xenopus tropicalis


Alignment Length:282 Identity:73/282 - (25%)
Similarity:122/282 - (43%) Gaps:33/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GVAGAIAQCFTAPFDLIEARM----------VVIKKDRGMASNLQQAIRTHGFISLYDGLSAQLL 76
            |.|..||..||.|.|..:.|:          |...:.:|:...:...::|.|..|||:||.|.|.
 Frog    21 GTAACIADLFTFPLDTAKVRLQIQGENKVVNVKAAQYKGVFGTISTMVKTEGPKSLYNGLVAGLQ 85

  Fly    77 RQLTYTSMRFHLYE-------MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNR 134
            ||:::.|:|..||:       .|.||:    |:..::......|.:|..|..|.:::..|.|...
 Frog    86 RQMSFASVRIGLYDSVKQFYTK
GSEHV----GIGSRLAAGCTTGAMAVAVAQPTDVVKVRFQAQA 146

  Fly   135 ALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMK 199
            ......|  |:........:.||||...|:.|...:..|::::..::...||..|....: .::.
 Frog   147 NSSANRR--YKGTMHAYRTIAREEGMRGLWKGTAPNITRNAIVNCTELVTYDIIKDSLLK-ANIM 208

  Fly   200 HDNTLLHLISSVTAAFVCGPIIKPIE--NLRYLRMVDSR--RLINSISYMMRFGSRGP---FRGM 257
            .||...|..|:..|.|....|..|::  ..||:.....:  ..||....|.|  ..||   ::|.
 Frog   209 TDNLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSAKGQYASAINCALTMFR--KEGPKAFYKGF 271

  Fly   258 VPYVLRMVPNTVITFLSFEQLR 279
            :|..||:....|:.|:::|||:
 Frog   272 MPSFLRLGSWNVVMFVTYEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 28/90 (31%)
Mito_carr 98..192 CDD:395101 19/93 (20%)
ucp2NP_989179.1 Mito_carr 11..107 CDD:365909 26/85 (31%)
Mito_carr 112..204 CDD:365909 19/97 (20%)
Mito_carr 211..297 CDD:365909 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.