DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and slc25a27

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:298 Identity:69/298 - (23%)
Similarity:131/298 - (43%) Gaps:46/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AGAIAQCFTAPFDLIEARM--------------VVIKKDRGMASNLQQAIRTHGFISLYDGLSAQ 74
            |.|:|:..|.|.||.:.|:              |..:|.|||.|.....:|..|.:.|:.|::..
Zfish    22 AAAVAELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLSTAAGIVREEGPLKLWQGVTPA 86

  Fly    75 LLRQLTYTSMRFHLYEMGKEHL-----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQV-- 132
            :.|.:.|:..|...||..:|.:     |....:...|:.:.::|.:...:.:|.:|:..:||:  
Zfish    87 IYRHIVYSGGRMLAYEQMRESVLGKSEDGIFPVWKAVIASMISGALGQFIASPTDLVKVQMQMEG 151

  Fly   133 -NRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFF 196
             .|...|..|  .|.|:....::..:.|...|::|...:..|::|:.:.....||..|.     |
Zfish   152 RRRLEGKPPR--VRGVYHAFTKIVAQGGIRGLWAGWVPNVQRAALVNLGDLMTYDTVKH-----F 209

  Fly   197 HMKH----DNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINS------------ISYM 245
            .:::    ||::.|.:||:.:..|...:..|.:.:: .|:::..|..|.            :..:
Zfish   210 LLRNTSIPDNSICHGLSSICSGLVAATMGTPADVVK-TRVMNQPRDSNGRGLLYRNSTDCLVQSV 273

  Fly   246 MRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNFG 283
            .|.|....::|.:|...||.|.::..:|:|||||...|
Zfish   274 RREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQLRRAMG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 24/85 (28%)
Mito_carr 98..192 CDD:395101 19/96 (20%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 24/89 (27%)
PTZ00169 16..310 CDD:240302 68/295 (23%)
Mito_carr 118..213 CDD:278578 20/101 (20%)
Mito_carr 217..311 CDD:278578 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.