DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and slc25a14

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:293 Identity:77/293 - (26%)
Similarity:131/293 - (44%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVIKKD-------RGMASNLQQAIRTHGFISLYDGLSAQLLRQ 78
            ||:|..:|:..|.|.||.:.|:.|..:.       |||...|.:..|..|..:||.|:|..||||
Zfish    61 GGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQ 125

  Fly    79 LTYTSMRFHLYEMGKE----HLDDPAGLLDKVLVAALAGCVAGVVGT----PMELINTRMQVNRA 135
            .:|.:::...|...|:    |.::     :.:::....|.|:||:.:    |.:::..|||...:
Zfish   126 ASYGTIKIGTYNTLKKLFVSHPEE-----ETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGS 185

  Fly   136 LPKETRW-NYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMK 199
            |.:.:.. |:.|::       :.||...|:.|...:..|::::...:...||..|         |
Zfish   186 LLQGSMMSNFMNIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITK---------K 234

  Fly   200 H--------DNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSISY-------MMRFG 249
            |        |..|.|.|||.|..........|::.:| .||::.|.|..:..|       |..:.
Zfish   235 HLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVR-TRMMNQRVLAGNPLYKGTLDGLMQTWR 298

  Fly   250 SRGPF---RGMVPYVLRMVPNTVITFLSFEQLR 279
            :.|.|   :|..|..||:.|..:|.|::||||:
Zfish   299 NEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 27/85 (32%)
Mito_carr 98..192 CDD:395101 19/98 (19%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.