DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG18418

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:292 Identity:80/292 - (27%)
Similarity:145/292 - (49%) Gaps:31/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KTKKIRPRWWSGGVAGAIAQCFTAPFDLIEARMVV-----IKKDRGMASNLQQAIRTHGFISLYD 69
            ||.....::..||.:|.:|.|...|.||::.||.:     .::.:.....|.:.::..|.:|||:
  Fly    10 KTVPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYN 74

  Fly    70 GLSAQLLRQLTYTSMRFHLYEMG----KEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRM 130
            ||||.||||.||||.:..:|:|.    :::..:...::..:.:..:||....:.|.|.|:...||
  Fly    75 GLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRM 139

  Fly   131 QVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAK-QIYAE 194
            ..:..|..|.|.||:||.|...|:.::||...|:.||..:..|:.::.:.|.|:|...| |::..
  Fly   140 MSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHGY 204

  Fly   195 FFHMKHDNTLLHLISSVTAAFVCG--------PIIKPIENLRYLRMVDSR-RLINSISYMMRF-- 248
            .    .:...|||    |||.|.|        |:......::.::::|.: ....:|..:.:.  
  Fly   205 L----SEGIPLHL----TAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLK 261

  Fly   249 --GSRGPFRGMVPYVLRMVPNTVITFLSFEQL 278
              |:...::|..||::||.|:|:.:|:..||:
  Fly   262 NEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/84 (35%)
Mito_carr 98..192 CDD:395101 27/94 (29%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 31/97 (32%)
PTZ00169 18..296 CDD:240302 78/284 (27%)
Mito_carr 109..205 CDD:278578 27/95 (28%)
Mito_carr 208..300 CDD:278578 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.