DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG7514

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:283 Identity:77/283 - (27%)
Similarity:140/283 - (49%) Gaps:16/283 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASN---LQQAIRTHGFISLYDGLSAQLLRQLTY 81
            :||:||.:..|...|.||::.||.:........|:   |.:..:..|.::||:||||.|:||.||
  Fly    18 NGGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATY 82

  Fly    82 TSMRFHLYEMG----KEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRW 142
            |:.|...|:|.    ::..:.|..:|..:.:..|||....:.|.|.|:...||..:..||...|.
  Fly    83 TTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERR 147

  Fly   143 NYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLLHL 207
            ||..|.:...|:.::||...|:.||..:..|:.::.:.|.|:|.|.|..::|:|    ....||:
  Fly   148 NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF----SGLSLHI 208

  Fly   208 ISSVTAAFVCGPIIKPIENLR-YLRMVDSRRLINSISYMMRF----GSRGPFRGMVPYVLRMVPN 267
            .:::.:..:......|::..: .::...:.....::..:|:.    |....::|..||:.|:.|:
  Fly   209 AAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPH 273

  Fly   268 TVITFLSFEQLRVNFGYIEIEDD 290
            ||..|:..|||...:.:|.:.||
  Fly   274 TVFAFIFLEQLTKAYKHIVLGDD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 28/82 (34%)
Mito_carr 98..192 CDD:395101 28/93 (30%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 74/272 (27%)
Mito_carr 19..90 CDD:278578 26/70 (37%)
Mito_carr 104..201 CDD:278578 29/96 (30%)
Mito_carr 207..284 CDD:278578 13/76 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.