DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and PMP34

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:301 Identity:70/301 - (23%)
Similarity:120/301 - (39%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQAIRT----HGFISLYDGLSAQLLRQLT 80
            ||...|.||.....|.|.:.:|:.:  ::.|...:.:|.|:.    .||.|||.||...|.....
  Fly    21 SGAAGGCIAMSTFYPLDTVRSRLQL--EEAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVLQSLCI 83

  Fly    81 YTSMRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGVVG----TPMELINTRMQVNR--ALPKE 139
            ...:.|:.:...|......:......|...|.|.:||::.    ||..::|||:::..  ....|
  Fly    84 SNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDE 148

  Fly   140 TRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTL 204
            ...:|:|:.:||..|..:||...|:||...|.|..|...: |...|:..|:....|...:..:..
  Fly   149 VNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPAL-QFMMYEMLKRNIMRFTGGEMGSLS 212

  Fly   205 LHLISSVTAAFVCGPIIKPIENLRY-LRMVDSRRLINS------------------------ISY 244
            ...|.::..||.        ..|.| |::|.:::...|                        ||.
  Fly   213 FFFIGAIAKAFA--------TVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISI 269

  Fly   245 MMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNFGYI 285
            :...|.||.|||:...:|:.|....:.|:::|::....|.:
  Fly   270 LQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVGML 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 21/79 (27%)
Mito_carr 98..192 CDD:395101 27/99 (27%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 20/76 (26%)
Mito_carr 105..202 CDD:278578 27/97 (28%)
Mito_carr 214..303 CDD:278578 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.