DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Tpc2

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:303 Identity:58/303 - (19%)
Similarity:119/303 - (39%) Gaps:53/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVI---------KKDRGMASNLQQAIRTHGFISLYDGLSAQLL 76
            ||:|||..:..|.|.|:::.|..:.         .|.||:....:......|...::.|.::..:
  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQV 80

  Fly    77 RQLTYTSMRFHLYEM--GKEHLDD---PAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRAL 136
            ..::|..::|..||.  ...|..|   ....|...:...:|||:..|...|.:::.|:|.   |.
  Fly    81 LSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMV---AA 142

  Fly   137 PKETRWNYRNVFDGLYRVTREEGFTKLYSG----------------CFLSFMRSSLITISQNAAY 185
            ...:|.:..|.|.||.:|.:.||:..|..|                .|..::.::::.....   
  Fly   143 DPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPP--- 204

  Fly   186 DQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRR----------LIN 240
            ||.::|:..|..:.      ..:|.|.|..:..|.....:.::.:.....|:          ::.
  Fly   205 DQRQEIHGAFLFLN------GALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILG 263

  Fly   241 SISYMMR-FGSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNF 282
            .|:...| .|..|.::||:|.:|:....:.:.|..::..:.::
  Fly   264 CITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 18/85 (21%)
Mito_carr 98..192 CDD:395101 23/112 (21%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 53/292 (18%)
Mito_carr 23..99 CDD:278578 13/75 (17%)
Mito_carr 108..194 CDD:278578 20/88 (23%)
Mito_carr 216..307 CDD:278578 14/97 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.