DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Shawn

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:357 Identity:78/357 - (21%)
Similarity:129/357 - (36%) Gaps:100/357 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KIRP-RWWSGGVAGA-IAQCFTAPFDLIEARMVVIKKDRGMASN--------LQQAI-------- 59
            :||| :..:....|| :..||..|.|:|:.|:..  :.:.:.||        |...|        
  Fly    36 RIRPLQQVASACTGAMVTACFMTPLDVIKTRLQA--QQQALLSNKCFLYCNGLMDHICPCGPDTP 98

  Fly    60 ----------------------RTHGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLDD---- 98
                                  ||.|..||:.|||..|:..|..|.:.|..||..|....|    
  Fly    99 NPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYK 163

  Fly    99 ----PAGLLDKV------LVAALAGCVAGVVG----TPMELINTRMQVNRALPKETRWNYRNVFD 149
                |..:...:      ||..|||....::.    :|:|||.|:||..|....|.....|.|..
  Fly   164 YTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMTHAEMFGTIRQVVQ 228

  Fly   150 -----GLYR-----VTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTL 204
                 ||:|     :.|:..|:.:|..|: .:::||...:....::..|                
  Fly   229 SQGVLGLWRGLPPTILRDVPFSGIYWTCY-EYLKSSFGVVEPTFSFSFA---------------- 276

  Fly   205 LHLISSVTAAFVCGP--IIKPIENLRY----------LRMVDSRRLINSISYMMRFGS-RGPFRG 256
            ...||...||.:..|  ::|..|.:.:          .:.|.::.:...::.:.|.|. ...|.|
  Fly   277 AGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSG 341

  Fly   257 MVPYVLRMVPNTVITFLSFEQLRVNFGYIEIE 288
            :.|.:.::.|...|...|||..:..|.:..|:
  Fly   342 LGPRLFKVAPACAIMISSFEYGKSFFYHYNID 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 27/114 (24%)
Mito_carr 98..192 CDD:395101 28/121 (23%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 28/121 (23%)
Mito_carr 178..265 CDD:278578 25/87 (29%)
Mito_carr 268..371 CDD:278578 20/118 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.