DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Tyler

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:320 Identity:67/320 - (20%)
Similarity:116/320 - (36%) Gaps:84/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RGMASNLQQAIRTHGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLD---------DPAGLLD 104
            ||......:.:.|.||..|:.|||..|:..|..|.:.|..||..|..|.         :.:|:.|
  Fly   122 RGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSH
IYLVSQKFEESGMKD 186

  Fly   105 KV--------LVAALAG------------------------CVAGVVG---TPMELINTRMQVNR 134
            :|        |..|..|                        |...:|.   ||:|::..:||   
  Fly   187 QVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQ--- 248

  Fly   135 ALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMK 199
                .....|..::..|..:.|:.|...|:.|...:.||.:..:.:..|.|:..|:.::......
  Fly   249 ----SEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFSVTEPTF 309

  Fly   200 HDNTLLHLISSVTAAFVCGPI--------IKPIENLRY-----------------------LRMV 233
            ..:.|...||...|.||..|.        |:..:::.|                       ..:.
  Fly   310 LFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSAVA 374

  Fly   234 DSR-RLINSISYMMRF-GSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNFGYIEIEDDE 291
            :|| .:::.:..:.|. |.||.:.|::|.:||:||...|...:||..:..|.:..::..|
  Fly   375 NSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFFFHYNLDLQE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 16/46 (35%)
Mito_carr 98..192 CDD:395101 24/128 (19%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 17/48 (35%)
Mito_carr 216..302 CDD:278578 18/92 (20%)
Mito_carr 306..429 CDD:278578 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.