DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG18324

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:291 Identity:65/291 - (22%)
Similarity:119/291 - (40%) Gaps:39/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARM----------VVIKKDRGMASNLQQAIRTHGFISLYDGLSAQL 75
            ||.|...|..||.|.|:::.||          ..:|..|.:...:.|.:...|.::|..||:..|
  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPAL 73

  Fly    76 LRQLTYTSMRFHLY----EMG-KEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRM--QVN 133
            ..|....|:|..:|    |:| .::.|........:...||.||......:|..:|..:.  |..
  Fly    74 CYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAV 138

  Fly   134 RALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHM 198
            :::....:..:.::.|.|..:.|..|.:..:.....|..|:.:.:..|...:.:||.:      :
  Fly   139 QSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSL------L 197

  Fly   199 KHDNTLLH-LISSVTAAFVCGPII----KPIENL---RYLRMVDS-------RRLINSISYMMRF 248
            |....:.| ::.|..|....|.::    .|.:.|   .|.:.||.       :.|::..:.:.|.
  Fly   198 KDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRT 262

  Fly   249 -GSRGPFRGMVPYVLRMVPNTVITFLSFEQL 278
             |..|.::|..|...|..|:|.:||:.||:|
  Fly   263 EGIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 24/89 (27%)
Mito_carr 98..192 CDD:395101 16/95 (17%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 21/77 (27%)
PTZ00169 5..293 CDD:240302 64/289 (22%)
Mito_carr 101..201 CDD:278578 17/105 (16%)
Mito_carr 204..296 CDD:278578 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.