DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG8323

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:293 Identity:68/293 - (23%)
Similarity:123/293 - (41%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIE----------ARMVVIKKDRGMASNLQQAIRTHGFISLYDGLSAQL 75
            ||:|...|..||.|.::|:          ||...::..:|:.:......:..|...|..||:..|
  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAPAL 73

  Fly    76 LRQLTYTSMRFHLYE--MGKEHLDDPAGLLDKVLVAALAGCVAGVVG----TPMELINTRMQVNR 134
            ..|....|.|..:|.  |.:..:.:..|.:...: ..|.|.:.||||    :|..||.|::|...
  Fly    74 YFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGM-GLLWGAIGGVVGCYFSSPFFLIKTQLQSQA 137

  Fly   135 ALPKETRWNYR----NVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEF 195
            |  |:....|:    ::.|.|.::....|...|:.|...:..|::|.:.:|.|.:.:.|.:..::
  Fly   138 A--KQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQY 200

  Fly   196 FHMKHDNTLLHLISSVTAAFVCGPI----IKP---IENLRYLRMVDS--RRLINS------ISYM 245
                 |......::|.:|..:.|.|    |.|   |....|.:.||:  |.|:..      :..:
  Fly   201 -----DLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKIL 260

  Fly   246 MRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQL 278
            ...|..|.::|.....||:.|::.:..|.|::|
  Fly   261 RSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 21/86 (24%)
Mito_carr 98..192 CDD:395101 25/101 (25%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 19/77 (25%)
PTZ00169 5..293 CDD:240302 67/291 (23%)
Mito_carr 101..200 CDD:278578 25/101 (25%)
Mito_carr 206..301 CDD:278578 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.