DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a30

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:294 Identity:73/294 - (24%)
Similarity:128/294 - (43%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVIKKD----------RGMASNLQQAIRTHGFISLYDGLSAQL 75
            ||:|...|:|.|.|.||.:.|:.:..:.          |||...|.:..|..|..:||.|::..:
  Rat    12 GGLASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIGREEGLRALYSGIAPAM 76

  Fly    76 LRQLTYTSMRFHLYE----MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQV-NRA 135
            |||.:|.:::...|:    :..|..:|.. ||..|:...|:|.::..:..|.:::..|||. |.|
  Rat    77 LRQASYGTIKIGTYQSLKRLAVERPEDET-LLINVVCGILSGVISSAIANPTDVLKIRMQAQNSA 140

  Fly   136 LPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKH 200
            :......|:.:::       ::||...|:.|..|:..|::::...:...||..|         ||
  Rat   141 VQGGMIGNFISIY-------QQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITK---------KH 189

  Fly   201 --------DNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINS------------ISYM 245
                    |....|.:||.|...|......|::.:| .||::.|.|.:.            :...
  Rat   190 LILSGLMGDTVSTHFLSSFTCGLVGALASNPVDVVR-TRMMNQRDLRDGRCSGYKGTLDCLLQTW 253

  Fly   246 MRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
            ...|....::|..|..||:.|..:|.||::|||:
  Rat   254 KNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 25/88 (28%)
Mito_carr 98..192 CDD:395101 22/94 (23%)
Slc25a30NP_001013205.1 Solcar 1 7..96 24/83 (29%)
PTZ00169 9..289 CDD:240302 73/294 (25%)
Solcar 2 104..189 21/101 (21%)
Solcar 3 198..289 24/91 (26%)
Mito_carr 199..289 CDD:395101 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.