DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Dic3

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:281 Identity:103/281 - (36%)
Similarity:160/281 - (56%) Gaps:18/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PRWWSGGVAGAIAQCFTAPFDLIEARM-VVIKKDRGMASNLQQAIRTH-GFISLYDGLSAQLLRQ 78
            ||||.|||..|||...|.|.|||:.:: ...:.||.....:.:.|... |.:..|:|:||...||
  Fly    10 PRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWFRQ 74

  Fly    79 LTYTSMRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWN 143
            ||||:.||.|||.||:::|... :..|:.:|..||.|.|:||.|.:::..|:|.:..||:|.|.|
  Fly    75 LTYTTTRFALYEAGKDYVDTQK-VSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRN 138

  Fly   144 YRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMK-----HDNT 203
            |::|||||:|:.:|||.:.|:.|...:..|:.|:||..||||||.||:      :|     .:..
  Fly   139 YKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQM------LKIATGAGEGV 197

  Fly   204 LLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSI-SYMMRFGSRGP---FRGMVPYVLRM 264
            .||..:|..|..:...|.:|::.::...|.......:.| ...:....:||   ::|.:|.::|:
  Fly   198 PLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIRV 262

  Fly   265 VPNTVITFLSFEQLRVNFGYI 285
            .|||:|||:.:||.|:.|||:
  Fly   263 SPNTIITFVLYEQARMRFGYL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 32/77 (42%)
Mito_carr 98..192 CDD:395101 40/93 (43%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 93/266 (35%)
Mito_carr 15..91 CDD:278578 32/75 (43%)
Mito_carr 93..187 CDD:278578 41/100 (41%)
Mito_carr 200..281 CDD:278578 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.