DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG4995

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:212 Identity:55/212 - (25%)
Similarity:85/212 - (40%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QLTYTSMRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGV-VGTPMELINTRMQVNRALPKETR 141
            ||..||..|           .|..::|  .||.|.|..||| ||.|.:.:...:|.:.  |:..:
  Fly    28 QLKATSETF-----------SPKMVVD--FVAGLLGGAAGVLVGHPFDTVKVHLQTDD--PRNPK 77

  Fly   142 WNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLL- 205
              |:..|.....:.:.:.|..||.|.........|:.......|...:::      ....|:|. 
  Fly    78 --YKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRL------SNDPNSLTS 134

  Fly   206 HL----ISSVTAAFVCGPIIKPIENLRYLRMVDS----RRLINSISYMMRF-GSRGPFRGMVPYV 261
            |.    |:.|...|||.|:......|:....|||    ...|:.:.|:::. |.||.|:|:...:
  Fly   135 HFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATI 199

  Fly   262 LRMVPNTVITFLSFEQL 278
            ||.:|.....|:|||.|
  Fly   200 LRDIPGFASYFVSFEYL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 5/17 (29%)
Mito_carr 98..192 CDD:395101 22/94 (23%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 23/105 (22%)
PTZ00169 41..295 CDD:240302 49/188 (26%)
Mito_carr 128..218 CDD:278578 28/89 (31%)
Mito_carr 221..304 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.